DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16986 and C25H3.14

DIOPT Version :9

Sequence 1:NP_001189035.1 Gene:CG16986 / 38325 FlyBaseID:FBgn0035356 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_495115.2 Gene:C25H3.14 / 182923 WormBaseID:WBGene00016123 Length:143 Species:Caenorhabditis elegans


Alignment Length:136 Identity:45/136 - (33%)
Similarity:75/136 - (55%) Gaps:3/136 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KGLEFAKHITEIINK--STGFESHLQKVKIVDGGDGACTAELKVDQDHVNLYKFLHGGYIMTLVD 68
            |.::.||.:.::...  ..|:.:..:.|:.|...:|....|.:|::|..|.::.||||....|:|
 Worm     4 KYMQIAKEVIKMFGTKGQFGYAAGARNVRAVHAEEGNLRVEFEVEKDQTNQFETLHGGCTAALID 68

  Fly    69 LITTYA-LMSKPCHPGVSVDLSVNFLNGAKLGDDVVIQANLSKVGKYLAFIDCTLKHKKDDLVIA 132
            ..||.| |::|...|||||||.:.:|..|.:|:.:|:.:.:.|.|:.|.|....|..|:|:.:||
 Worm    69 CFTTGALLLTKEARPGVSVDLHITYLTAANIGETLVLNSTVIKQGRSLGFTKAELYRKRDNAMIA 133

  Fly   133 KGTHLK 138
            .|.|.|
 Worm   134 TGVHTK 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16986NP_001189035.1 PaaI_thioesterase 31..140 CDD:239527 41/109 (38%)
C25H3.14NP_495115.2 PaaI_thioesterase 31..140 CDD:239527 41/109 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I6286
eggNOG 1 0.900 - - E1_COG2050
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I3667
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55852
OrthoDB 1 1.010 - - D1607235at2759
OrthoFinder 1 1.000 - - FOG0002696
OrthoInspector 1 1.000 - - otm14389
orthoMCL 1 0.900 - - OOG6_101688
Panther 1 1.100 - - O PTHR21660
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1714
SonicParanoid 1 1.000 - - X2936
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.870

Return to query results.
Submit another query.