DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16985 and AT3G61200

DIOPT Version :9

Sequence 1:NP_647730.1 Gene:CG16985 / 38323 FlyBaseID:FBgn0035355 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_191679.1 Gene:AT3G61200 / 825292 AraportID:AT3G61200 Length:188 Species:Arabidopsis thaliana


Alignment Length:138 Identity:32/138 - (23%)
Similarity:56/138 - (40%) Gaps:24/138 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DFVKQMS--EYASGSNGFD----------RVLKMIKITGGGDGRAIGEFTVANEHLNRQGTLHGG 61
            ||.|.:|  |..:....||          |.|.:.:      ||.....||.....|....||||
plant    43 DFFKAISPDESCNDFTSFDSFSVLFQNNTRALSIAR------GRVSCSVTVTPGISNFFKGLHGG 101

  Fly    62 LTATIVDN----CTTYALMSKGSHPGVTANLNVSYIAAAKPGELIEIDCNTVRAGKKMAYLDCIL 122
            ..|:|.:.    |.. .::|:..|..: ..|::||:::|.....:.::...||.|:.::.:....
plant   102 AVASIAERVAMACVK-TVVSEDKHLFI-GELSMSYLSSAPISSELLVEGTVVRTGRNLSVVTVEF 164

  Fly   123 RRKSDGKI 130
            :.|...|:
plant   165 KIKETMKV 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16985NP_647730.1 PaaI_thioesterase 31..140 CDD:239527 23/104 (22%)
AT3G61200NP_191679.1 PaaI_thioesterase 72..181 CDD:239527 25/109 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2050
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1607235at2759
OrthoFinder 1 1.000 - - FOG0002696
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21660
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.