DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16985 and them4

DIOPT Version :9

Sequence 1:NP_647730.1 Gene:CG16985 / 38323 FlyBaseID:FBgn0035355 Length:149 Species:Drosophila melanogaster
Sequence 2:XP_021322437.1 Gene:them4 / 791152 ZFINID:ZDB-GENE-070112-982 Length:260 Species:Danio rerio


Alignment Length:92 Identity:26/92 - (28%)
Similarity:45/92 - (48%) Gaps:4/92 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 GTLHGGLTATIVDNCTTYALMSKGSHPGVTANLNVSYIAAAKPGELIEIDCNTVRAGKKMAYLDC 120
            |.:|||..||::|. .|..|....|.|.||||||::|.:....|.::.|.|...|...:..::.|
Zfish   155 GHVHGGAIATMIDT-VTGTLAGYLSGPSVTANLNINYRSPVPLGSVVIIHCALDRIEGRKTFITC 218

  Fly   121 ILRRKSDGKIIAKG---GQVKYIQFDK 144
            .:....:.|:..:.   ..::|:.:.|
Zfish   219 KVTSTDESKVYTEATADASIRYVLYYK 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16985NP_647730.1 PaaI_thioesterase 31..140 CDD:239527 24/86 (28%)
them4XP_021322437.1 PaaI_thioesterase 136..234 CDD:239527 24/79 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.