DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16985 and AT1G52191

DIOPT Version :9

Sequence 1:NP_647730.1 Gene:CG16985 / 38323 FlyBaseID:FBgn0035355 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001117468.1 Gene:AT1G52191 / 6241250 AraportID:AT1G52191 Length:138 Species:Arabidopsis thaliana


Alignment Length:112 Identity:34/112 - (30%)
Similarity:56/112 - (50%) Gaps:8/112 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VLKMIKITGGGDGRAIGEFTVANEHLNRQGTLHGGLTATIVDNCTTYALMSK-GSHPGVTANLNV 90
            :|:.:::...|.|....:.||.:..||..||||......:::.....|:.|. |||..|  :||.
plant     5 ILEGLQVIHVGRGIVRCKLTVTHHVLNEDGTLHTAAIGVLMELMGAIAIYSAGGSHTSV--DLNY 67

  Fly    91 SYIAAAKPGELIEIDCNTVRAGKKMAYLDCI---LRRKSDGKIIAKG 134
            |..:.||..|.|:|:...|  ||:...|:..   :||:.:.::||.|
plant    68 SLYSTAKIQEEIKIEARVV--GKRSENLNSAIIEIRREYEEELIATG 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16985NP_647730.1 PaaI_thioesterase 31..140 CDD:239527 33/108 (31%)
AT1G52191NP_001117468.1 PaaI_thioesterase 8..>89 CDD:239527 26/84 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2050
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1607235at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR21660
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.