DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16985 and acot13

DIOPT Version :9

Sequence 1:NP_647730.1 Gene:CG16985 / 38323 FlyBaseID:FBgn0035355 Length:149 Species:Drosophila melanogaster
Sequence 2:XP_005159692.1 Gene:acot13 / 564010 ZFINID:ZDB-GENE-060503-437 Length:146 Species:Danio rerio


Alignment Length:136 Identity:54/136 - (39%)
Similarity:86/136 - (63%) Gaps:1/136 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LGMDFVKQMSEYASGSNGFDRVLKMIKITGGGDGRAIGEFTVANEHLNRQGTLHGGLTATIVDNC 70
            |.::.|||:....:.|.||||||..:::.....|:.:.|..|..:|.||.||||||:|||:||..
Zfish     9 LTLNTVKQIFRAMADSPGFDRVLSKVEVLSAAPGKVVCEMKVEEQHTNRGGTLHGGMTATLVDMI 73

  Fly    71 TTYALM-SKGSHPGVTANLNVSYIAAAKPGELIEIDCNTVRAGKKMAYLDCILRRKSDGKIIAKG 134
            :|.|:| |:...|||:.::|::|:.|||.||.|.|....::.|:.:|:....|..|::||:||:|
Zfish    74 STMAIMYSERGAPGVSVDMNITYMNAAKIGEDILITAQVLKQGRTLAFATVDLTNKANGKLIAQG 138

  Fly   135 GQVKYI 140
            ...|::
Zfish   139 RHTKHL 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16985NP_647730.1 PaaI_thioesterase 31..140 CDD:239527 43/109 (39%)
acot13XP_005159692.1 PaaI_thioesterase 31..144 CDD:239527 44/112 (39%)
4HBT_3 58..>141 CDD:290352 36/82 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593925
Domainoid 1 1.000 66 1.000 Domainoid score I9931
eggNOG 1 0.900 - - E1_COG2050
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 106 1.000 Inparanoid score I4911
OMA 1 1.010 - - QHG55852
OrthoDB 1 1.010 - - D1607235at2759
OrthoFinder 1 1.000 - - FOG0002696
OrthoInspector 1 1.000 - - otm26522
orthoMCL 1 0.900 - - OOG6_101688
Panther 1 1.100 - - LDO PTHR21660
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1714
SonicParanoid 1 1.000 - - X2936
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.