DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16985 and ACOT13

DIOPT Version :9

Sequence 1:NP_647730.1 Gene:CG16985 / 38323 FlyBaseID:FBgn0035355 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_060943.1 Gene:ACOT13 / 55856 HGNCID:20999 Length:140 Species:Homo sapiens


Alignment Length:134 Identity:53/134 - (39%)
Similarity:83/134 - (61%) Gaps:7/134 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DFVKQMSEYASGSNGFDRVLKMIKITGGGDGRAIGEFTVANEHLNRQGTLHGGLTATIVDNCTTY 73
            :.:|.|::    :..|:|||..|.:.....|:.|.|..|..||.|..||||||||||:|||.:|.
Human    10 EVIKAMTK----ARNFERVLGKITLVSAAPGKVICEMKVEEEHTNAIGTLHGGLTATLVDNISTM 70

  Fly    74 ALM--SKGSHPGVTANLNVSYIAAAKPGELIEIDCNTVRAGKKMAYLDCILRRKSDGKIIAKGGQ 136
            ||:  .:|: |||:.::|::|::.||.||.|.|..:.::.||.:|:....|..|:.||:||:|..
Human    71 ALLCTERGA-PGVSVDMNITYMSPAKLGEDIVITAHVLKQGKTLAFTSVDLTNKATGKLIAQGRH 134

  Fly   137 VKYI 140
            .|::
Human   135 TKHL 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16985NP_647730.1 PaaI_thioesterase 31..140 CDD:239527 47/110 (43%)
ACOT13NP_060943.1 PaaI_thioesterase 25..138 CDD:239527 48/113 (42%)
Coenzyme A binding. /evidence=ECO:0000269|PubMed:19170545, ECO:0007744|PDB:3F5O 90..95 1/4 (25%)
Coenzyme A binding. /evidence=ECO:0000269|PubMed:19170545, ECO:0007744|PDB:3F5O 108..113 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158061
Domainoid 1 1.000 64 1.000 Domainoid score I10130
eggNOG 1 0.900 - - E1_COG2050
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 98 1.000 Inparanoid score I5025
Isobase 1 0.950 - 0 Normalized mean entropy S4138
OMA 1 1.010 - - QHG55852
OrthoDB 1 1.010 - - D1607235at2759
OrthoFinder 1 1.000 - - FOG0002696
OrthoInspector 1 1.000 - - otm40609
orthoMCL 1 0.900 - - OOG6_101688
Panther 1 1.100 - - LDO PTHR21660
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2936
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.720

Return to query results.
Submit another query.