DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16985 and CG16986

DIOPT Version :9

Sequence 1:NP_647730.1 Gene:CG16985 / 38323 FlyBaseID:FBgn0035355 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001189035.1 Gene:CG16986 / 38325 FlyBaseID:FBgn0035356 Length:143 Species:Drosophila melanogaster


Alignment Length:143 Identity:63/143 - (44%)
Similarity:91/143 - (63%) Gaps:0/143 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAAKKLGMDFVKQMSEYASGSNGFDRVLKMIKITGGGDGRAIGEFTVANEHLNRQGTLHGGLTAT 65
            |..:|.|::|.|.::|..:.|.||:..|:.:||..||||....|..|..:|:|....||||...|
  Fly     1 MGTRKKGLEFAKHITEIINKSTGFESHLQKVKIVDGGDGACTAELKVDQDHVNLYKFLHGGYIMT 65

  Fly    66 IVDNCTTYALMSKGSHPGVTANLNVSYIAAAKPGELIEIDCNTVRAGKKMAYLDCILRRKSDGKI 130
            :||..||||||||..||||:.:|:|:::..||.|:.:.|..|..:.||.:|::||.|:.|.|..:
  Fly    66 LVDLITTYALMSKPCHPGVSVDLSVNFLNGAKLGDDVVIQANLSKVGKYLAFIDCTLKHKKDDLV 130

  Fly   131 IAKGGQVKYIQFD 143
            ||||..:|||:||
  Fly   131 IAKGTHLKYIKFD 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16985NP_647730.1 PaaI_thioesterase 31..140 CDD:239527 49/108 (45%)
CG16986NP_001189035.1 PaaI_thioesterase 31..140 CDD:239527 49/108 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467646
Domainoid 1 1.000 60 1.000 Domainoid score I3869
eggNOG 1 0.900 - - E1_COG2050
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I2429
Isobase 1 0.950 - 0 Normalized mean entropy S4138
OMA 1 1.010 - - QHG55852
OrthoDB 1 1.010 - - D1607235at2759
OrthoFinder 1 1.000 - - FOG0002696
OrthoInspector 1 1.000 - - otm26522
orthoMCL 1 0.900 - - OOG6_101688
Panther 1 1.100 - - P PTHR21660
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1714
SonicParanoid 1 1.000 - - X2936
1413.790

Return to query results.
Submit another query.