DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16985 and C25H3.3

DIOPT Version :9

Sequence 1:NP_647730.1 Gene:CG16985 / 38323 FlyBaseID:FBgn0035355 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_872068.1 Gene:C25H3.3 / 353396 WormBaseID:WBGene00016112 Length:148 Species:Caenorhabditis elegans


Alignment Length:115 Identity:45/115 - (39%)
Similarity:68/115 - (59%) Gaps:9/115 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 ITGGGDGRAIG--------EFTVANEHLNRQGTLHGGLTATIVDNCTTYA-LMSKGSHPGVTANL 88
            ::|.|:.||:.        ||.|..:..|...|||||.|:|::|..||.| |::|.:.|||:.:|
 Worm    25 VSGAGNVRAVHAEEGNLRVEFEVEKDQSNHFNTLHGGCTSTLIDIFTTGALLLTKPARPGVSVDL 89

  Fly    89 NVSYIAAAKPGELIEIDCNTVRAGKKMAYLDCILRRKSDGKIIAKGGQVK 138
            :|:|:.|||.||.:.:|...::.||.:|:....|.||||..:||.|...|
 Worm    90 HVTYLTAAKIGETLVLDSTVIKQGKTLAFTKAELYRKSDNVMIATGVHTK 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16985NP_647730.1 PaaI_thioesterase 31..140 CDD:239527 45/115 (39%)
C25H3.3NP_872068.1 PaaI_thioesterase 28..140 CDD:239527 44/112 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I6286
eggNOG 1 0.900 - - E1_COG2050
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55852
OrthoDB 1 1.010 - - D1607235at2759
OrthoFinder 1 1.000 - - FOG0002696
OrthoInspector 1 1.000 - - otm14389
orthoMCL 1 0.900 - - OOG6_101688
Panther 1 1.100 - - O PTHR21660
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1714
SonicParanoid 1 1.000 - - X2936
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.820

Return to query results.
Submit another query.