DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16985 and F42H10.6

DIOPT Version :9

Sequence 1:NP_647730.1 Gene:CG16985 / 38323 FlyBaseID:FBgn0035355 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_498872.1 Gene:F42H10.6 / 176198 WormBaseID:WBGene00018370 Length:169 Species:Caenorhabditis elegans


Alignment Length:123 Identity:48/123 - (39%)
Similarity:68/123 - (55%) Gaps:15/123 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GSNGFDRVLKMIKITGGGDGRAIGEFTVANEHLNRQGTLHGGLTATIVDNCTTYALMSKGSHPGV 84
            ||..|:||.:.:........:.:.|..|.::|||.:||||||.|||:.|..|..|:       ||
 Worm    33 GSTNFNRVAEDVYPVEVTKSKLVCEMVVQHQHLNSKGTLHGGQTATLTDVITARAV-------GV 90

  Fly    85 T--------ANLNVSYIAAAKPGELIEIDCNTVRAGKKMAYLDCILRRKSDGKIIAKG 134
            |        ..|.|||:...|.|:::||..:.::.|:.||:.||..|||||||:.|||
 Worm    91 TVKDKGMASVELAVSYLLPVKVGDVLEITAHVLKVGRTMAFTDCEFRRKSDGKMSAKG 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16985NP_647730.1 PaaI_thioesterase 31..140 CDD:239527 43/112 (38%)
F42H10.6NP_498872.1 PaaI_thioesterase 43..153 CDD:239527 43/113 (38%)
4HBT_3 69..>164 CDD:290352 38/87 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2050
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I3732
Isobase 1 0.950 - 0 Normalized mean entropy S4138
OMA 1 1.010 - - QHG55852
OrthoDB 1 1.010 - - D1607235at2759
OrthoFinder 1 1.000 - - FOG0002696
OrthoInspector 1 1.000 - - otm14389
orthoMCL 1 0.900 - - OOG6_101688
Panther 1 1.100 - - LDO PTHR21660
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1714
SonicParanoid 1 1.000 - - X2936
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.860

Return to query results.
Submit another query.