DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dos and PHLDB3

DIOPT Version :10

Sequence 1:NP_523890.2 Gene:dos / 38321 FlyBaseID:FBgn0016794 Length:878 Species:Drosophila melanogaster
Sequence 2:NP_942147.3 Gene:PHLDB3 / 653583 HGNCID:30499 Length:640 Species:Homo sapiens


Alignment Length:163 Identity:40/163 - (24%)
Similarity:52/163 - (31%) Gaps:69/163 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RTFYEGW--------------------LIKSPPTKRIWRARWRRRYFTLKQGEIPEQFC------ 41
            |...|||                    |:|.....:.||.||               ||      
Human   512 RQHLEGWGHNPENCPHVQVSGCCCRGPLVKMGGRIKTWRKRW---------------FCFDRQAR 561

  Fly    42 -LEYYTDHNCRKLKGVIDLDQCEQV-----DCGLRLENRKQKFQYMFDIKTPKRTYYLAAETEAD 100
             |.||.|....||||||.....|:|     .|..:..|.:    ..|.:||.:|.:|:.|.:...
Human   562 RLAYYADKEETKLKGVIYFQAIEEVYYDHLRCAFKSPNPR----LTFCVKTYERLFYMVAPSPEA 622

  Fly   101 MRDWVNCICQVCHLHDTKQSNELPLGAVGADEN 133
            ||.|::.|                  ...||||
Human   623 MRIWMDVI------------------VTAADEN 637

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dosNP_523890.2 PH_Gab2_2 2..115 CDD:241535 36/143 (25%)
PHLDB3NP_942147.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..100
SMC_prok_B <111..>322 CDD:274008
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 162..189
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 241..262
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 387..412
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 476..504
PH_PHLDB1_2 535..635 CDD:270192 32/136 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.