DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dos and apbb1ip

DIOPT Version :10

Sequence 1:NP_523890.2 Gene:dos / 38321 FlyBaseID:FBgn0016794 Length:878 Species:Drosophila melanogaster
Sequence 2:NP_956928.2 Gene:apbb1ip / 393607 ZFINID:ZDB-GENE-040426-1318 Length:645 Species:Danio rerio


Alignment Length:182 Identity:45/182 - (24%)
Similarity:68/182 - (37%) Gaps:33/182 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 WRRRYFTLKQGEIPEQFCLEYYTDHNCRKL-KGVIDLDQCEQVDCGLRLENR---KQKFQYMFDI 84
            |::|||.|:...:       ||:.....|. :.::.|.|.:.|:.....|.|   |....:.|.:
Zfish   309 WKQRYFLLRASGL-------YYSPKGKTKASRDLVCLVQFDNVNVYYCKEYRIKYKAPTDHCFML 366

  Fly    85 KTP---KRTYY---LAAETEADMRDWVNCICQVC----HLHDTKQSNELPLGAVGADENRTQHTS 139
            |.|   |.:.|   :..:.|..|..||..| :|.    .|:|..::.........:..|||...|
Zfish   367 KHPQIQKESQYIKFMCCDDEWSMNLWVTGI-RVAKYGKQLYDNYKAAVRKASGSASWANRTIQAS 430

  Fly   140 SSGGLSNSTQNTTTTSLHSSAGTTAPQASVPNAGGSAQLRRPAVIEEQPMPS 191
            |:....:.|......:.|      |||..|.|...|.|...|     .|.||
Zfish   431 STASTPSPTPKAKAANGH------APQPPVENKVPSNQSSLP-----PPPPS 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dosNP_523890.2 PH_Gab2_2 2..115 CDD:241535 25/104 (24%)
apbb1ipNP_956928.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 82..141
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.