DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dos and GAB4

DIOPT Version :10

Sequence 1:NP_523890.2 Gene:dos / 38321 FlyBaseID:FBgn0016794 Length:878 Species:Drosophila melanogaster
Sequence 2:XP_016884064.1 Gene:GAB4 / 128954 HGNCID:18325 Length:575 Species:Homo sapiens


Alignment Length:63 Identity:11/63 - (17%)
Similarity:24/63 - (38%) Gaps:14/63 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 REPIPEKQQR------------ELFKWMLEEKRKVNPKNAEEKKRNDEEKAILK--QFIGSKT 133
            :.|.|.::|:            ::..|.:..:|::.....::..|..:..|...  |.||..|
Human   200 QHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGAAFSPEGQPIGGYT 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dosNP_523890.2 PH_Gab2_2 2..115 CDD:241535 5/41 (12%)
GAB4XP_016884064.1 PH-like 38..158 CDD:473070
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.