DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16758 and CG31115

DIOPT Version :9

Sequence 1:NP_001261330.1 Gene:CG16758 / 38315 FlyBaseID:FBgn0035348 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_733068.2 Gene:CG31115 / 318597 FlyBaseID:FBgn0051115 Length:290 Species:Drosophila melanogaster


Alignment Length:321 Identity:75/321 - (23%)
Similarity:115/321 - (35%) Gaps:85/321 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 ELRALRVLNEDTYPYEVIEEIADFITKGSGMRPKIGIICGSGLGSLADMIQDPKIFEYEKIPNFP 164
            :|.....|.:||.|.                  |||||..:.|        |..|:..|:: .:.
  Fly     4 DLEVQSELEKDTIPI------------------KIGIIGEANL--------DKPIYLAERM-EYA 41

  Fly   165 VSTVEGHAGRLVV-GTLEGATV--MAMQGRFHFYEGYPLAKCSMP--------VRVMKLCGVEYL 218
            |.|..|....::: |.:||..|  ::..||.|..         ||        |..|:..|..::
  Fly    42 VCTPFGKPSDVIIDGQIEGVNVCLLSRNGRNHDI---------MPSNINYRANVWAMRKMGCTHI 97

  Fly   219 FATNAAGGINPRFAVGDIMLMHDHVNML---------GFAGNSPL---QGPNDPRFGPRFPALVN 271
            ..||....:...|..|.:::.:|.::..         |..| |||   ..|.:|.|..|      
  Fly    98 LVTNTFSSLRDTFQPGHLVVPNDVIDYTSRRAQTFYDGAVG-SPLGVCHVPMNPTFCER------ 155

  Fly   272 SYNKDLINKAIEIAKAMGIESNIHVGVYSCLGGPNYETIAELKALRMMGVDAVGMSTVHEVITAR 336
             ..:.|::.|.|:....|..     |....|.||.|.|:||....|..|.|.:.|:...|.|.|:
  Fly   156 -TRQHLLSAAEELGFPTGSS-----GTVLTLEGPRYSTVAENNMFRKWGADLLSMTLCPEAILAK 214

  Fly   337 HCDMKVFAFSLITNK---CATEYSDKKDDEANHDEVMAVAK----NRQKACCELVSRLIRE 390
            ...:...:..|:||.   ||      |...|...|::.:.|    |.||.....:..:..|
  Fly   215 EAGIPYASLGLVTNMECWCA------KQPNATTHEIIYIFKKQSENLQKVLITAIRNMAAE 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16758NP_001261330.1 PRK08202 113..391 CDD:236183 71/308 (23%)
XapA 116..391 CDD:223084 70/305 (23%)
CG31115NP_733068.2 XapA 12..266 CDD:223084 72/308 (23%)
PNP_UDP_1 19..264 CDD:294213 69/281 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449089
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0005
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.