DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16758 and SPAC16C9.02c

DIOPT Version :9

Sequence 1:NP_001261330.1 Gene:CG16758 / 38315 FlyBaseID:FBgn0035348 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_593076.1 Gene:SPAC16C9.02c / 2542316 PomBaseID:SPAC16C9.02c Length:307 Species:Schizosaccharomyces pombe


Alignment Length:289 Identity:62/289 - (21%)
Similarity:102/289 - (35%) Gaps:73/289 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 IGIICGSGLGSLA--DMIQDPKIFEYEKIPNFPVSTVEGHAGRLVVGTLEGATVMAMQGRFHFYE 196
            :|:|.|||...|.  |:::..........|..|:|.....:|.|:       ..:|..|..|.| 
pombe    10 LGVIGGSGFYDLPGFDIVESVNPITPWGYPASPISIARTTSGFLI-------AFLARHGVGHIY- 66

  Fly   197 GYPLAKCSMPVR----VMKLCGVEYLFATNAAGGINPRFAVGDIMLMHDHVNMLGFAGNSPLQ-- 255
                ....:|.|    .:|..||..:.:.:|.|.:.......|.:|              |.|  
pombe    67 ----TPTEVPSRANIAALKSLGVLAIVSFSAVGSLREDIPPEDFVL--------------PTQII 113

  Fly   256 ------GPN--------------DPRFGPRFPALVNSYNKDLINKAIEIAKAMGIESNIHVGVYS 300
                  .||              || |......:::|...:|.|.:....|..|.:..:     .
pombe   114 DRTLCARPNTFFESGCVAHVSFGDP-FDQDLYEILSSCGSNLKNGSKLHTKRKGDDLTV-----V 172

  Fly   301 CLGGPNYETIAELKALRMMGVDAVGMSTVHEVITARHCDMKVFAFSLITNKC-ATEYS--DKKDD 362
            |:.||.:.|.||....|..|...:.||.:.|...||..::   |:.::   | ||:|.  ...::
pombe   173 CMEGPAFSTRAESNLYRSWGASIINMSVIPEAKLAREAEI---AYQMV---CMATDYDCWRMNEE 231

  Fly   363 EANHDEVMA-VAKNRQKA---CCELVSRL 387
            ....:.||. ::.|:..|   ..|.|.:|
pombe   232 PVTVETVMEHISNNKDNAKIFLLEAVKKL 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16758NP_001261330.1 PRK08202 113..391 CDD:236183 62/289 (21%)
XapA 116..391 CDD:223084 62/289 (21%)
SPAC16C9.02cNP_593076.1 XapA 6..260 CDD:223084 61/287 (21%)
MTAP 9..259 CDD:273762 61/286 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0005
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.