DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16758 and diras3

DIOPT Version :9

Sequence 1:NP_001261330.1 Gene:CG16758 / 38315 FlyBaseID:FBgn0035348 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001107372.1 Gene:diras3 / 100135197 XenbaseID:XB-GENE-978992 Length:198 Species:Xenopus tropicalis


Alignment Length:137 Identity:36/137 - (26%)
Similarity:50/137 - (36%) Gaps:42/137 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 EDTYPYEVIE--------EIADFITKGSGMRP---KIGIICGSGLGSLADMIQDPKIFE----YE 158
            |||| .:||.        :|.|  |.||...|   ::.|..|.....:..:.....:.|    ||
 Frog    41 EDTY-RQVISCDKNICTLQITD--TTGSHQFPAMQRLSISKGHAFILVYSVTSKQSMEELQPIYE 102

  Fly   159 KI-------PNFPVSTVEGHAGRLVVGTLEGATVMAMQGRFHFYEGYPLA---KCSMPVRVMKL- 212
            :|       .|.|:         ::||.....|:..:|..    ||..||   |||......|| 
 Frog   103 QICQIKGDTQNIPI---------MLVGNKSDETLREVQAS----EGECLANKWKCSFMETSAKLN 154

  Fly   213 CGVEYLF 219
            ..|:.||
 Frog   155 YNVQELF 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16758NP_001261330.1 PRK08202 113..391 CDD:236183 32/133 (24%)
XapA 116..391 CDD:223084 32/130 (25%)
diras3NP_001107372.1 ARHI_like 7..169 CDD:206711 36/137 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165166585
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.