DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d20 and CYP4F2

DIOPT Version :9

Sequence 1:NP_647723.2 Gene:Cyp4d20 / 38311 FlyBaseID:FBgn0035344 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_001073.3 Gene:CYP4F2 / 8529 HGNCID:2645 Length:520 Species:Homo sapiens


Alignment Length:469 Identity:152/469 - (32%)
Similarity:239/469 - (50%) Gaps:64/469 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 YGKTFRFWILGE-----SLIYTKDLQYFETILSSTTLLEKGQ-LYEYLRPFLNDGLLVSTGRKWH 125
            |.:.|:.| :|.     ||.:...::  ..|.:|..:..|.: .|.:|.|:|.||||:|.|.||.
Human    84 YPQGFKVW-MGPISPLLSLCHPDIIR--SVINASAAIAPKDKFFYSFLEPWLGDGLLLSAGDKWS 145

  Fly   126 ARRKIFTHAFHFKVLEHYVEIMDRHSSVMVDNLRKVA-DGKTAVDMLKYVSLAALDVITEAAMGV 189
            ..|::.|.||||.:|:.|::|.:...::|....:.:| :|...:||.:::||..||.:.:.....
Human   146 RHRRMLTPAFHFNILKPYMKIFNESVNIMHAKWQLLASEGSACLDMFEHISLMTLDSLQKCVFSF 210

  Fly   190 QVNAQNDPDFPYIKA---LKSVV---------------YIQPDRMFRFSRRYNWLFPLAAPLLHR 236
            ..:.|..|. .||.|   |.::|               |:.||.. ||.|.              
Human   211 DSHCQEKPS-EYIAAILELSALVSKRHHEILLHIDFLYYLTPDGQ-RFRRA-------------- 259

  Fly   237 QLLSDIRVMHDFTDKVISERRETVRRAKADGTYRPLSLGDAEIGSKSQMALLD----ILLQSSIN 297
                 .|::|||||.||.|||.|:          |....|..:.:|::...||    :||....:
Human   260 -----CRLVHDFTDAVIQERRRTL----------PSQGVDDFLQAKAKSKTLDFIDVLLLSKDED 309

  Fly   298 NQPLSDADIREEVDTFMFEGDDTTSSGVSHALYAIARHPEVQQRIFEELQRVLGPDASAPVTQAQ 362
            .:.|||.|||.|.|||||||.|||:||:|..||.:|:|||.|:|..:|:|.:|.......:....
Human   310 GKKLSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQERCRQEVQELLKDREPKEIEWDD 374

  Fly   363 LQDLKYLDCVIKETMRLYPPVPAIGRHAQKELEIGD-KTIPANTSIYLVLYYAHRDANYFPDPLS 426
            |..|.:|...:||::||:||||.|.||..:::.:.| :.||......:.::..|.:...:|||..
Human   375 LAHLPFLTMCMKESLRLHPPVPVISRHVTQDIVLPDGRVIPKGIICLISVFGTHHNPAVWPDPEV 439

  Fly   427 FRPERFLEDQEQGHNTFAYVPFSAGPKNCIGQKFAVLEMKVLISKVLRFYELLPLGEELKPMLNF 491
            :.|.||..:..:..:..|::||||||:|||||.||:.||||:::..|..:.:||...|.:.....
Human   440 YDPFRFDPENIKERSPLAFIPFSAGPRNCIGQTFAMAEMKVVLALTLLRFRVLPDHTEPRRKPEL 504

  Fly   492 ILRSASGINVGLRP 505
            :||:..|:.:.:.|
Human   505 VLRAEGGLWLRVEP 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d20NP_647723.2 p450 34..493 CDD:278495 148/455 (33%)
CYP4F2NP_001073.3 DUF4175 4..>57 CDD:372724
p450 52..515 CDD:365848 151/464 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154781
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.