DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d20 and CYP702A8

DIOPT Version :9

Sequence 1:NP_647723.2 Gene:Cyp4d20 / 38311 FlyBaseID:FBgn0035344 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_189648.1 Gene:CYP702A8 / 822729 AraportID:AT3G30290 Length:408 Species:Arabidopsis thaliana


Alignment Length:372 Identity:83/372 - (22%)
Similarity:163/372 - (43%) Gaps:56/372 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 NDGLLVSTGRKWHAR----RKIFTHAFHFKVLEHYVEIMDRHSSVMVDNLRKVADGKTAVDMLKY 173
            |:..|.||....|.|    :.:.:.:...:::|: ::::.|  :.|.:..|   ||  ::|:.:.
plant    47 NNLFLQSTESHKHVRNLTVQMLGSQSLKLRIMEN-IDLLTR--THMEEGAR---DG--SLDVKET 103

  Fly   174 VSLAALDVITEAAMGVQVNAQNDPDFPYIKALKSVV----YIQPDRMFRFSRRYNWLFPLAAPLL 234
            .|...::.:.:..||     :.:|:     |.|.:.    |. |...||..      |.|....:
plant   104 TSKILIECLAKKVMG-----EMEPE-----AAKKLALCWRYF-PSGWFRLP------FNLPGIGV 151

  Fly   235 HRQLLSDIRVMHDFTDKVISERRETVRRAKADGTYRPLSLGDAEIGSKSQMALLDILLQSSINNQ 299
            :..:.:..|:.....::|:.:|    ...:..|.:..:..|:.| |.|..|::.:::        
plant   152 YNMMKARKRMKTLLKEEVLKKR----EAGEEFGEFSKIIFGEKE-GEKETMSMKNVI-------- 203

  Fly   300 PLSDADIREEVDTFMFEGDDTTSSGVSHALYAIARHPEVQQRIFEELQRVL-GPDASAPVTQAQL 363
                    |.:.||....::||...::..:..|:.:|:|.|.:..|...:. .....|.:|....
plant   204 --------EYIYTFFVIANETTPRILAATVKFISENPKVMQELQREHAMIFENKSEEAGLTWEDY 260

  Fly   364 QDLKYLDCVIKETMRLYPPVPAIGRHAQKELEIGDKTIPANTSIYLVLYYAHRDANYFPDPLSFR 428
            :.:.:.:.||.|::|:...||.|.|....:.::||.||||..: ::....||.|...:.|||.|.
plant   261 KSMTFTNMVINESLRISTTVPVILRKPDHDTKVGDYTIPAGWN-FMGYPSAHFDPTKYEDPLEFN 324

  Fly   429 PERFLEDQEQGHNTFAYVPFSAGPKNCIGQKFAVLEMKVLISKVLRF 475
            |.|:..:......:..|:||.|||:.|:|..||.|.|.:.|..:.|:
plant   325 PWRWKGNDLDAIVSTNYIPFGAGPRLCVGAYFAKLLMAIFIHHLCRY 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d20NP_647723.2 p450 34..493 CDD:278495 83/372 (22%)
CYP702A8NP_189648.1 p450 5..374 CDD:299894 83/372 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.