DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d20 and Cyp4x1

DIOPT Version :9

Sequence 1:NP_647723.2 Gene:Cyp4d20 / 38311 FlyBaseID:FBgn0035344 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_001003947.1 Gene:Cyp4x1 / 81906 MGIID:1932403 Length:507 Species:Mus musculus


Alignment Length:512 Identity:163/512 - (31%)
Similarity:271/512 - (52%) Gaps:48/512 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ALILLLTWDFGRKRQRVLAFEKSAIPGPISIPILGCGLQALHLGAENIIGWVGEKFD----KYGK 69
            ||:|:.......:|||:|. :.|..|||.:..:||   ....|..:|:     |..|    |:..
Mouse    23 ALVLMQAMKLYLRRQRLLR-DLSPFPGPPAHWLLG---HQKFLQEDNM-----ETLDEIVKKHPC 78

  Fly    70 TFRFWILG--ESLIYTKDLQYFETILSSTTLLEKGQ-LYEYLRPFLNDGLLVSTGRKWHARRKIF 131
            .|..|: |  ::..|..|..|.:..||.|.  .|.| |::.|.|.:..|||...|.:|...|.:.
Mouse    79 AFPCWV-GPFQAFFYIYDPDYAKIFLSRTD--PKMQYLHQLLTPCIGRGLLNLDGPRWFQHRCLL 140

  Fly   132 THAFHFKVLEHYVEIMDRHSSVMVDNLRKV-ADGKTAVDMLKYVSLAALDVITEAAMGVQVNAQ- 194
            |.|||..:|:..|:.|.....||:|...|: ...:|.:::.::::|..||:|.:.|.|.:.|.| 
Mouse   141 TPAFHQDILKPCVDTMAHSVKVMLDKWEKMWTTQETTIEVFEHINLMTLDIIMKCAFGQETNCQI 205

  Fly   195 NDPDFPYIKALKSVVYIQPDRMFRFSRRYNWLFPLAAPLLH-RQLLSDIRVMHDFTDKVISERRE 258
            |.....|:||...:..|...|::.|...::.:|.| :|..| .|.|.  :|:|.:|:|:|.:|::
Mouse   206 NGTYESYVKATFELGEIISSRLYNFWHHHDIIFKL-SPKGHCFQELG--KVIHQYTEKIIQDRKK 267

  Fly   259 TVR-RAKADGTYRPLSLGDAEIGSKSQMALLDILLQSSINNQ-PLSDADIREEVDTFMFEGDDTT 321
            .:: :.|.|.|             ::....|||:|.:...:: ..||||:|.||:|||:.|.|.:
Mouse   268 ILKNQVKQDDT-------------QTSQIFLDIVLSAQAEDERAFSDADLRAEVNTFMWAGHDAS 319

  Fly   322 SSGVSHALYAIARHPEVQQRIFEELQRVLGPDASAPVTQAQLQDLKYLDCVIKETMRLYPPVPAI 386
            ::.:|..||.:|.:||.|.|...|::.:||..:|  :|..||.::.|....||||:||.||||:|
Mouse   320 AASISWLLYCLALNPEHQDRCRTEIRSILGDGSS--ITWEQLDEMSYTTMCIKETLRLIPPVPSI 382

  Fly   387 GRHAQKELEIGD-KTIPANTSIYLVLYYAHRDANYFPDPLSFRPERFLEDQEQGHNTFAYVPFSA 450
            .|...|.|.:.| .::||..::.|.::..|.:...:.||..|.|.||.::.....:..|::|||:
Mouse   383 SRELSKPLTLPDGHSLPAGMTVVLSIWGLHHNPAVWNDPKVFDPLRFTKENSDQRHPCAFLPFSS 447

  Fly   451 GPKNCIGQKFAVLEMKVLISKVLRFYELLPLGEELKP---MLNFILRSASGINVGLR 504
            ||:|||||:||:||:||.|:.:|..:::.|  :..:|   ..:.:||...||.:.|:
Mouse   448 GPRNCIGQQFAMLELKVAIALILLHFQVAP--DLTRPPAFSSHTVLRPKHGIYLHLK 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d20NP_647723.2 p450 34..493 CDD:278495 150/474 (32%)
Cyp4x1NP_001003947.1 p450 47..499 CDD:278495 154/482 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845102
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.