DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d20 and Cyp6a21

DIOPT Version :9

Sequence 1:NP_647723.2 Gene:Cyp4d20 / 38311 FlyBaseID:FBgn0035344 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_611003.2 Gene:Cyp6a21 / 36665 FlyBaseID:FBgn0033981 Length:504 Species:Drosophila melanogaster


Alignment Length:504 Identity:107/504 - (21%)
Similarity:212/504 - (42%) Gaps:77/504 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 IIGWVGEKFDKYGKTFRFW-----------ILGESLIYTKDLQYFETILSS-------------- 95
            ::..||....|:..|.|.|           ||..|:...:..:.|..|.:|              
  Fly    11 LLALVGYLLMKWRSTMRHWQDLGIPCEEPHILMGSMKGVRTARSFNEIWTSYYNKFRGSGPFAGF 75

  Fly    96 -----------TTLLEKGQLYEYLRPFLNDG-------------LLVSTGRKWHARRKIFTHAFH 136
                       .|.|.|..|.:....|.:.|             |.:..|:||...|...:..|.
  Fly    76 YWFRRPAVFVLETSLAKQILIKEFNKFTDRGFFHNPEDDPLSGQLFLLDGQKWRTMRNKLSSTFT 140

  Fly   137 FKVLEH----YVEIMDRHSSVMVDNLRKVADGKTAVDMLKYVSLAALDVITEAAMGVQVNAQNDP 197
            ...:::    .|::.:..:.|...|:.|    ...|::.:.::....|||...|.|::.::..||
  Fly   141 SGKMKYMFPTVVKVANEFTDVFGQNVAK----SPVVEVRELLARFTTDVIGTCAFGIECSSLKDP 201

  Fly   198 DFPYIKALKSVVYIQPDRMFRFSRRYNWLFPLAAPLLHRQLLSDIRVMHDFTDKVISERRETVRR 262
            |..:.:..:..:..|  |:......:...||..|..||.::.::  .:..|..:::   |||| .
  Fly   202 DAEFREMGRRSLTEQ--RLGPVGIGFVNSFPNLARRLHMKMTAE--PIERFFMRIV---RETV-A 258

  Fly   263 AKADGTYRPLSLGDAEIGSKSQMALLDILLQSSINNQPLSDADIREEVDTFMFEGDDTTSSGVSH 327
            .:.....|.....|..|..|::    .:::..|..:..|:..:|..:...|...|.:|:|:.:..
  Fly   259 FREQNNIRRNDFMDQLIDLKNK----PLMVSQSGESVNLTIEEIAAQAFVFFAAGFETSSTTMGF 319

  Fly   328 ALYAIARHPEVQQRIFEELQRVLGPDASAPVTQAQLQDLKYLDCVIKETMRLYPPVPAIGRHAQK 392
            |||.:|::.::|.|:.:|.|.|: ...:..:....::||.|||.|:.||:|||..:|.:.|...:
  Fly   320 ALYELAQNQDIQNRVRKECQEVI-EKCNGELNYESMKDLVYLDQVVSETLRLYTVLPVLNRECLE 383

  Fly   393 ELEIGDK---TIPANTSIYLVLYYAHRDANYFPDPLSFRPERFLEDQEQGHNTFAYVPFSAGPKN 454
            :.|:...   .|.....:.:.....|||...:.:|.:|.|:.|..::.:..::..::||..||:|
  Fly   384 DYEVPGHPKYVIKKGMPVLIPCGAMHRDEKLYANPNTFNPDNFSPERVKERDSVEWLPFGDGPRN 448

  Fly   455 CIGQKFAVLEMKVLISKVLRFYELLPLGEELKPML----NFILRSASGI 499
            |||.:|..::.::.::.:::.::.....:...||.    .|::.|.|||
  Fly   449 CIGMRFGQMQARIGLALLIKDFKFSVCEKTTIPMTYNKEMFLIASNSGI 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d20NP_647723.2 p450 34..493 CDD:278495 103/496 (21%)
Cyp6a21NP_611003.2 p450 35..499 CDD:278495 101/480 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.