DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d20 and LOC103692784

DIOPT Version :9

Sequence 1:NP_647723.2 Gene:Cyp4d20 / 38311 FlyBaseID:FBgn0035344 Length:510 Species:Drosophila melanogaster
Sequence 2:XP_038935978.1 Gene:LOC103692784 / 103692784 RGDID:9252969 Length:337 Species:Rattus norvegicus


Alignment Length:343 Identity:112/343 - (32%)
Similarity:174/343 - (50%) Gaps:18/343 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 MLKYVSLAALDVITEAAMGVQVNAQNDPDFPYIKALKSVVYIQPDRMFRFSRRYNWLFPLAAPLL 234
            |.:.:||..||.:.:...|...|.|..|. .||.|:..:..:...|.::.....::|:...|.  
  Rat     1 MFENISLMTLDSLQKCLFGFDSNCQESPS-EYISAILELSSLTIKRSYQLFLYLDFLYYRTAD-- 62

  Fly   235 HRQLLSDIRVMHDFTDKVISERRETVRRAKADGTYRPLSLGDAEIGSKSQMALLD----ILLQSS 295
            .|:......::|.|||.||.|||   |...:.|....|     |..:||:...||    :||...
  Rat    63 GRRFRKACDLVHSFTDAVIRERR---RLLSSQGVDEFL-----ESKTKSKSKTLDFIDVLLLAKD 119

  Fly   296 INNQPLSDADIREEVDTFMF--EGDDTTSSGVSHALYAIARHPEVQQRIFEELQRVLGPDASAPV 358
            .:.:.|||.|||.|.|||||  |..|||:|.:|..||.:|||||.|:...:|:..:|.......:
  Rat   120 EHGKELSDEDIRAEADTFMFGDESHDTTASTLSWILYNLARHPEYQESCLQEVWELLRDREPEEI 184

  Fly   359 TQAQLQDLKYLDCVIKETMRLYPPVPAIGRHAQKELEIGD-KTIPANTSIYLVLYYAHRDANYFP 422
            ....|..|.:|...|||::||:||...:.|...:::.:.| :.||......:.::..|.:.:.:|
  Rat   185 EWDDLAQLPFLTMCIKESLRLHPPAVDLLRRCTQDIVLPDGRVIPKGNICVISIFGIHHNPSVWP 249

  Fly   423 DPLSFRPERFLEDQEQGHNTFAYVPFSAGPKNCIGQKFAVLEMKVLISKVLRFYELLPLGEELKP 487
            ||..:.|.||..:..|..:..:::||||||:|||||.||:.||||.::..|..:.|||..:|.:.
  Rat   250 DPEVYDPFRFDPESRQKRSPLSFIPFSAGPRNCIGQTFAMNEMKVAVALTLLRFRLLPDDKEPRR 314

  Fly   488 MLNFILRSASGINVGLRP 505
            ....|||:..|:.:.:.|
  Rat   315 KPEIILRAEGGLRLLVEP 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d20NP_647723.2 p450 34..493 CDD:278495 107/329 (33%)
LOC103692784XP_038935978.1 cytochrome_P450 <1..328 CDD:425388 111/337 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.