DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Svil and capg

DIOPT Version :9

Sequence 1:NP_001286919.1 Gene:Svil / 38306 FlyBaseID:FBgn0266696 Length:4526 Species:Drosophila melanogaster
Sequence 2:NP_001011294.1 Gene:capg / 496747 XenbaseID:XB-GENE-5811032 Length:346 Species:Xenopus tropicalis


Alignment Length:400 Identity:83/400 - (20%)
Similarity:144/400 - (36%) Gaps:124/400 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly  4069 DDYGHFYSAESYIVRWIYQISVTVRELSGKVSNRSTVGRDRCVYFTWQGQDSSANEKGAAALLTV 4133
            :.:|.|:|.::|::                |.|.|    :....|.|.|.|:|.:|:.|.|:.:.
 Frog    37 ESHGVFHSGDTYLL----------------VFNSS----ESNSIFVWNGSDTSVDERAAGAIYSF 81

  Fly  4134 ELDK---EKGAQMRVSQGDECTAFVRLFR----------QMWQHRGRKEQCLERHSEWRLYQLQG 4185
            :|.|   ||..|.:.:||:|...|:.||.          ....||..::...   ..:.||.::|
 Frog    82 QLHKHLREKPVQNQETQGNESAEFMSLFPLGVTYLDGGVSSGFHRASQDTVA---PTYHLYHVRG 143

  Fly  4186 NVSEETIIKEVVCQSSHLRSRS-----SMLLIHGSQGNVIVWHGSKSAPHTRNVAVGVAQDLIKT 4245
            .       |::....:.|:..|     ..:|..|.  ::.||.||:|....||.|..:|..:   
 Frog   144 R-------KQIRAAETELKWESFNKGDCFILDTGK--SIYVWSGSQSNILERNRARDLAYQI--- 196

  Fly  4246 VPKDLFSAETANLTEVEEGSDDDQCKKALGL---------------KDERNEYGSLLKSTKSFDY 4295
              :|......|.:..::||.:.::..|.||.               .|||:..|:.|        
 Frog   197 --RDSERRGAAKVEIIQEGEEPEEMIKILGKCPESLRDANAEDDKEADERHTKGATL-------- 251

  Fly  4296 QIRIFNFSSTQGVFKALELSDPLRCQDLHSPYPFSQSQLYNARQPTIFLLDDGDELWLWMGWWPL 4360
                :..|:..|..:...:.|...         |.:.||.:   ...|:||...::::|.|    
 Frog   252 ----YKVSNASGQMQVTHVGDGAL---------FHKEQLIS---DDCFILDCVGKIYVWKG---- 296

  Fly  4361 EDVKINTDERSSPTNENRAGVNRWISERRAALETAVDYWRAKHGENENEPFHGIKGQVVWAGLEP 4425
              .:.|.:|:......    .|.::|..|.:..|.|                    |||..|.|.
 Frog   297 --KRANKEEQDCSLKT----ANEFLSLMRYSPTTQV--------------------QVVSEGNES 335

  Fly  4426 LAFKALFPDW 4435
            ..|:..|.:|
 Frog   336 PLFRQFFRNW 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SvilNP_001286919.1 gelsolin_S2_like 3733..3825 CDD:200445
gelsolin_like 3859..3965 CDD:200436
ADF_gelsolin <4069..4158 CDD:301701 24/91 (26%)
gelsolin_S5_like 4176..4279 CDD:200444 24/122 (20%)
ADF_gelsolin 4328..4435 CDD:301701 22/106 (21%)
VHP 4492..4526 CDD:280388
capgNP_001011294.1 ADF_gelsolin 18..119 CDD:387665 26/101 (26%)
gelsolin_S2_like 136..224 CDD:200445 22/101 (22%)
gelsolin_S3_like 249..344 CDD:200448 26/148 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1376537at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.