DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15877 and LOC498154

DIOPT Version :9

Sequence 1:NP_647718.1 Gene:CG15877 / 38304 FlyBaseID:FBgn0035337 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001020204.1 Gene:LOC498154 / 498154 RGDID:1566418 Length:193 Species:Rattus norvegicus


Alignment Length:213 Identity:53/213 - (24%)
Similarity:92/213 - (43%) Gaps:31/213 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 RHKESEVSATKKQSRKNQAEEQVATSGSDESLPQKPQKRKQVQDAN------ETKKLKRSKTQEN 117
            :.|...:..|.|:|:|.:......|..:.|:.|.|......||:|:      |.:.|:|...:|.
  Rat     3 KQKRKGLERTAKESKKQKITPAEETPRASEARPGKEAASPVVQEASPELSPEERRVLERKLKKER 67

  Fly   118 NSDEDDDVDSQPTAAQLKEAARPENAYAVVTVRQKKKQKHQQRLEAQKSQSSNKDAKVNKEYLLK 182
            ..:|         ..:|:||       .:.|.:..|.|....:..|         |.:..|||..
  Rat    68 KKEE---------KKRLREA-------GIATAQTAKVQTPPAKPSA---------AVLALEYLQG 107

  Fly   183 WKESRQDWKFNKLRQISIQQTAFDVEKLDDELWPTALEYLASSQGAARSKISQLAEEVIQKLDKE 247
            |.|.::.|:|.|.||..:....:|.:|:.::.:.|.|:||...:|:||....|.||.::|:||..
  Rat   108 WAEKQESWRFQKTRQTWLLLHMYDEDKVPEQHFSTLLDYLEGLRGSARELTVQKAETLMQELDGT 172

  Fly   248 GEKLEDEAERRKLIESTQ 265
            ..|.....:.::|.:..|
  Rat   173 DPKARSLGKMQRLRQVLQ 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15877NP_647718.1 DUF2373 178..239 CDD:287189 21/60 (35%)
LOC498154NP_001020204.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..77 18/82 (22%)
DUF2373 103..163 CDD:287189 20/59 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 1.000 Domainoid score I11732
eggNOG 1 0.900 - - E1_KOG4829
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I5266
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008073
OrthoInspector 1 1.000 - - oto98425
orthoMCL 1 0.900 - - OOG6_105869
Panther 1 1.100 - - LDO PTHR22306
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.820

Return to query results.
Submit another query.