DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15877 and c9h7orf50

DIOPT Version :9

Sequence 1:NP_647718.1 Gene:CG15877 / 38304 FlyBaseID:FBgn0035337 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_017952971.2 Gene:c9h7orf50 / 100493126 -ID:- Length:223 Species:Xenopus tropicalis


Alignment Length:227 Identity:56/227 - (24%)
Similarity:100/227 - (44%) Gaps:31/227 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 RRHKESEVSATK-KQSRKNQAEEQVATSGSDESLPQKPQKRKQVQDANETKKLKRSKTQENNSDE 121
            |:..|:.|...| |:::|..|       |.:|      ::.||.:..:|...:|:.|........
 Frog    15 RKKAEASVRMAKDKEAKKKSA-------GKNE------RRVKQTETKSEAAPVKKRKLDSEVPRG 66

  Fly   122 DDDVDSQPTAAQLKEAA--RPENAYAVVTVRQKKKQKHQQRLEAQKSQSSNKD-------AKVNK 177
            .|...||..|....|.|  .||....:....:|:.:|.::||:.:.::...::       .::..
 Frog    67 SDSAVSQEEANDNLELAGLTPEECRVLERKLKKELKKEEKRLKRESAEQEKEEGPQKPSGCELAL 131

  Fly   178 EYLLKWKESRQDWKFNKLRQISIQQTAFDVEKLDDELWPTALEYLASSQGAARSKISQLAEEVIQ 242
            :||..|.:..::|||.|.||..:....:|.||:.|:.:...|.|:|..||.||....:.||.:::
 Frog   132 QYLKSWSKKHEEWKFQKTRQTWLLLHMYDPEKVPDKYFKILLNYIAGLQGRARDTTVEKAEALMK 196

  Fly   243 KLDKEGEKLEDEAERRKLIESTQYRRARDLLQ 274
            :.|....:.||...:        ..|.||:||
 Frog   197 QYDSSETQEEDHVPK--------LARIRDVLQ 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15877NP_647718.1 DUF2373 178..239 CDD:287189 21/60 (35%)
c9h7orf50XP_017952971.2 DUF2373 132..193 CDD:401988 21/60 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11642
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 70 1.000 Inparanoid score I5148
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008073
OrthoInspector 1 1.000 - - oto105121
Panther 1 1.100 - - LDO PTHR22306
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.