DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL23 and AT4G39880

DIOPT Version :10

Sequence 1:NP_523889.1 Gene:mRpL23 / 38302 FlyBaseID:FBgn0035335 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_195698.1 Gene:AT4G39880 / 830147 AraportID:AT4G39880 Length:178 Species:Arabidopsis thaliana


Alignment Length:130 Identity:37/130 - (28%)
Similarity:58/130 - (44%) Gaps:10/130 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VFLPNFWMKLIRPTEEQPPNVVTFSVSM--EMTKYDVRNYLEKIYKLPVVDVRTRIAMGETKKDQ 80
            |...|..:||:.|.  :..|:..|::..  ..:|.:::..||.:|...|..|.|....|  ||.:
plant    10 VHFANLPIKLLMPA--KLTNIHEFALKTIPSASKIEIKRVLESLYGFDVEKVNTLNMDG--KKKK 70

  Fly    81 TYGYITKKDDVKLAYVTLPREESF---VFP-DFFSEKAEKQAKEEKSLDESKAGFRRFLDRNKKR 141
            ..|.:..|.|.|.|||||....|.   :|| .:..|..:.:.|....::|.......:|||.:||
plant    71 RGGLLIAKADYKKAYVTLRSPLSISRDLFPVKYIEEDRKSKVKGSSFVEEEDDKKSHWLDRKEKR 135

  Fly   142  141
            plant   136  135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL23NP_523889.1 Ribosomal_L23 <37..105 CDD:459743 22/72 (31%)
AT4G39880NP_195698.1 Ribosomal_L23 <37..89 CDD:459743 18/53 (34%)

Return to query results.
Submit another query.