DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL23 and Mrpl23

DIOPT Version :10

Sequence 1:NP_523889.1 Gene:mRpL23 / 38302 FlyBaseID:FBgn0035335 Length:150 Species:Drosophila melanogaster
Sequence 2:XP_063128831.1 Gene:Mrpl23 / 64360 RGDID:68343 Length:165 Species:Rattus norvegicus


Alignment Length:145 Identity:63/145 - (43%)
Similarity:85/145 - (58%) Gaps:5/145 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YPIYQRGNPQLRVFLPNFWMKLIRPTEEQPPNVVTFSVSMEMTKYDVRNYLEKIYKLPVVDVRTR 70
            ||:||.|.||||||..||:::|:||...||.:.|.|.:.||||:.|:|||||:||.:||..||||
  Rat    26 YPLYQLGGPQLRVFRTNFFIQLVRPGTAQPEDTVQFRIPMEMTRVDLRNYLEQIYNVPVAAVRTR 90

  Fly    71 IAMGETKKDQTYGYITKKDDVKLAYVTLPREESFVFPDFFSEKAEKQAKEEKSLDESKAGFRRFL 135
            :..|..::........||.|.|:|||.|...::|.|||.|   .||:......|:|.....|:..
  Rat    91 VQHGSNRRRDHKNVRIKKPDYKVAYVQLAHGQTFTFPDLF---PEKEPTSPDPLEEELPQQRQSS 152

  Fly   136 DRNKKRPGTPGWFSI 150
            |  .:.||.|.||.:
  Rat   153 D--PRCPGIPSWFGL 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL23NP_523889.1 Ribosomal_L23 <37..105 CDD:459743 29/67 (43%)
Mrpl23XP_063128831.1 None

Return to query results.
Submit another query.