DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL23 and mrpl23

DIOPT Version :10

Sequence 1:NP_523889.1 Gene:mRpL23 / 38302 FlyBaseID:FBgn0035335 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_001107679.1 Gene:mrpl23 / 496986 XenbaseID:XB-GENE-5756147 Length:153 Species:Xenopus tropicalis


Alignment Length:152 Identity:64/152 - (42%)
Similarity:87/152 - (57%) Gaps:12/152 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YPIYQRGNPQLRVFLPNFWMKLIRPTEEQPPNVVTFSVSMEMTKYDVRNYLEKIYKLPVVDVRTR 70
            ||:||.||||||||..||.|.|:||..||||:...|.:.:||||.||:|||:.||.:||..||||
 Frog     7 YPLYQLGNPQLRVFRTNFQMTLVRPGREQPPDTAQFRIPLEMTKADVQNYLQSIYSVPVATVRTR 71

  Fly    71 IAMGETKKDQTYGYITKKDDVKLAYVTLPREESFVFPDFFSEKAEKQAKEEKSLDESKAGFRRFL 135
            |..|..:|........|:.|.|:|||.|.:.::|.|||.|.:|  .:..|..:.:|.:   ..|:
 Frog    72 IQYGSNRKRNHLNQRVKRPDYKVAYVQLGQGQTFQFPDLFPQK--DKTPESGTFEEVE---EEFM 131

  Fly   136 DRNK-------KRPGTPGWFSI 150
            :..|       :|.|...||.:
 Frog   132 ENEKQRQKNDPRRGGLNDWFGL 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL23NP_523889.1 Ribosomal_L23 <37..105 CDD:459743 28/67 (42%)
mrpl23NP_001107679.1 Ribosomal_L23 <42..105 CDD:459743 28/62 (45%)

Return to query results.
Submit another query.