DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL23 and mRpL23

DIOPT Version :10

Sequence 1:NP_523889.1 Gene:mRpL23 / 38302 FlyBaseID:FBgn0035335 Length:150 Species:Drosophila melanogaster
Sequence 2:XP_559130.1 Gene:mRpL23 / 3291064 VectorBaseID:AGAMI1_013048 Length:151 Species:Anopheles gambiae


Alignment Length:151 Identity:101/151 - (66%)
Similarity:127/151 - (84%) Gaps:1/151 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTRWYPIYQRGNPQLRVFLPNFWMKLIRPTEEQPPNVVTFSVSMEMTKYDVRNYLEKIYKLPVV 65
            ||:|||||||||||||||||||||:||:||..|||||||.|:.|||||::||:|||||||.:|||
Mosquito     1 MSSRWYPIYQRGNPQLRVFLPNFWLKLVRPANEQPPNVVQFACSMEMTRHDVKNYLEKIYNVPVV 65

  Fly    66 DVRTRIAMGETKKDQTYGYITKKDDVKLAYVTLPREESFVFPDFFSEKAEKQAKEE-KSLDESKA 129
            :||||||:|.||:|...|||||::|.|.|||||||.:.|.|||.|...|:::.::: |||:::|.
Mosquito    66 NVRTRIALGGTKRDLVLGYITKEEDTKYAYVTLPRTKQFTFPDIFPTDAKQKIEDDKKSLEDAKK 130

  Fly   130 GFRRFLDRNKKRPGTPGWFSI 150
            ..::|||:||.||||||||||
Mosquito   131 NHKKFLDKNKDRPGTPGWFSI 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL23NP_523889.1 Ribosomal_L23 <37..105 CDD:459743 45/67 (67%)
mRpL23XP_559130.1 Ribosomal_L23 <37..98 CDD:459743 41/60 (68%)

Return to query results.
Submit another query.