DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL23 and mrp20

DIOPT Version :10

Sequence 1:NP_523889.1 Gene:mRpL23 / 38302 FlyBaseID:FBgn0035335 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_592920.1 Gene:mrp20 / 2543038 PomBaseID:SPAC31A2.08 Length:161 Species:Schizosaccharomyces pombe


Alignment Length:91 Identity:33/91 - (36%)
Similarity:50/91 - (54%) Gaps:4/91 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VFLPNFWMKLIRPTEEQPPNVVTFSVSMEMTKYDVRNYLEKIYKLPVVDVRTRIAMGETKKDQTY 82
            |:.||....|.|....||...| |.|.:.:.|:|||:||:.:|.|.||.|::||..|:..::| .
pombe    10 VYFPNITFTLCRGLNLQPKFAV-FRVPLHVNKFDVRDYLQHVYNLKVVSVKSRIYQGKLFRNQ-L 72

  Fly    83 GYITKKDDVKLAYVTLPREESFVFPD 108
            |.:.:....|...|.:  ||.||:|:
pombe    73 GQVKRPQSEKRVIVEM--EEPFVYPN 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL23NP_523889.1 Ribosomal_L23 <37..105 CDD:459743 23/67 (34%)
mrp20NP_592920.1 Ribosomal_L23 22..90 CDD:459743 23/71 (32%)

Return to query results.
Submit another query.