DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL23 and Mrpl23

DIOPT Version :10

Sequence 1:NP_523889.1 Gene:mRpL23 / 38302 FlyBaseID:FBgn0035335 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_001404137.1 Gene:Mrpl23 / 19935 MGIID:1196612 Length:171 Species:Mus musculus


Alignment Length:148 Identity:64/148 - (43%)
Similarity:87/148 - (58%) Gaps:5/148 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TRWYPIYQRGNPQLRVFLPNFWMKLIRPTEEQPPNVVTFSVSMEMTKYDVRNYLEKIYKLPVVDV 67
            |..||:||.|.||||||..||:::|:||...||.:.|.|.:.||||:.|:|||||:||.:||..|
Mouse    29 TERYPLYQLGGPQLRVFRTNFFIQLVRPGTAQPEDTVQFRIPMEMTRVDLRNYLEQIYNVPVAAV 93

  Fly    68 RTRIAMGETKKDQTYGYITKKDDVKLAYVTLPREESFVFPDFFSEKAEKQAKEEKSLDESKAGFR 132
            |||:..|..::........||.|.|:|||.|...::|.|||.|   .||..:..:.|:|.....|
Mouse    94 RTRVQHGSNRRRDHKNVRIKKPDYKVAYVQLAHGQTFTFPDLF---PEKDPRSPEPLEEELPQQR 155

  Fly   133 RFLDRNKKRPGTPGWFSI 150
            :..|  .:.||.|.||.:
Mouse   156 QSSD--LRCPGIPSWFGL 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL23NP_523889.1 Ribosomal_L23 <37..105 CDD:459743 29/67 (43%)
Mrpl23NP_001404137.1 Ribosomal_L23 <67..130 CDD:459743 28/62 (45%)

Return to query results.
Submit another query.