DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL23 and mrpl-23

DIOPT Version :10

Sequence 1:NP_523889.1 Gene:mRpL23 / 38302 FlyBaseID:FBgn0035335 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_001379816.1 Gene:mrpl-23 / 188274 WormBaseID:WBGene00020348 Length:159 Species:Caenorhabditis elegans


Alignment Length:158 Identity:62/158 - (39%)
Similarity:87/158 - (55%) Gaps:24/158 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTRWYPIYQRGNPQLRVFLPNFWMKLIR-PT---EEQPPNVVTFSVSMEMTKYDVRNYLEKIYK 61
            |::|...::|.||||.|||||:|||.::. |:   ...|.|.|.|.|...|:::|:|.||.|||.
 Worm     1 MTSRLARLWQPGNPQRRVFLPDFWMAVVESPSVGRNRLPRNCVKFEVDPRMSRHDIREYLTKIYD 65

  Fly    62 LPVVDVRTRIAMGE----TKKDQTYGYITKKD-DVKLAYVTLPREESFVFPDFFSE--------K 113
            |||.||||.:.||:    :|.|..|.....|| |.|:|||.:.:...|.:|..|..        |
 Worm    66 LPVRDVRTEVQMGDITWNSKLDHQYKKAMWKDEDKKIAYVFMSKGFEFSYPQMFEALEEDLELVK 130

  Fly   114 AEKQAKEEK-SLDESKAGFRRFLDRNKK 140
            |.||.:|.| .|:|      |:.:||::
 Worm   131 AMKQQEELKDKLNE------RYANRNRR 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL23NP_523889.1 Ribosomal_L23 <37..105 CDD:459743 31/72 (43%)
mrpl-23NP_001379816.1 Ribosomal_L23 <41..110 CDD:459743 31/68 (46%)

Return to query results.
Submit another query.