Sequence 1: | NP_647716.1 | Gene: | CG8993 / 38301 | FlyBaseID: | FBgn0035334 | Length: | 142 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_024307057.1 | Gene: | TXNL1 / 9352 | HGNCID: | 12436 | Length: | 292 | Species: | Homo sapiens |
Alignment Length: | 101 | Identity: | 24/101 - (23%) |
---|---|---|---|
Similarity: | 46/101 - (45%) | Gaps: | 9/101 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 37 VQSAEDFDKKVKNS-QQPVIVDFFATWCNPCKLLTPRIESIVGEQAGSIKLAKVDIDEHSELALD 100
Fly 101 YDVAAVPVLVVLQNGKEVQR-----MVGLQDEDKIR 131 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8993 | NP_647716.1 | Thioredoxin_like | 39..138 | CDD:294274 | 23/99 (23%) |
TXNL1 | XP_024307057.1 | TRX_family | 12..104 | CDD:239245 | 21/94 (22%) |
PITH | 128..268 | CDD:399305 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1482186at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 1 | 0.900 | - | - | OOG6_100096 | |
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |