DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8993 and TRX2

DIOPT Version :9

Sequence 1:NP_647716.1 Gene:CG8993 / 38301 FlyBaseID:FBgn0035334 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_011725.3 Gene:TRX2 / 853123 SGDID:S000003441 Length:104 Species:Saccharomyces cerevisiae


Alignment Length:108 Identity:41/108 - (37%)
Similarity:65/108 - (60%) Gaps:10/108 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IFKVQSAEDFDKKVKNSQQPVIVDFFATWCNPCKLLTPRIESIVGEQAGSIKLAKVDIDEHSELA 98
            :.:::||.::|..:.:..:.|:||||||||.|||::.|.||.. .||.......|:|:||.|::|
Yeast     2 VTQLKSASEYDSALASGDKLVVVDFFATWCGPCKMIAPMIEKF-AEQYSDAAFYKLDVDEVSDVA 65

  Fly    99 LDYDVAAVPVLVVLQNGKEVQRMVGLQDEDKIRAWVAAAVKQA 141
            ...:|:::|.|:..:.||||.|:||..         .||:|||
Yeast    66 QKAEVSSMPTLIFYKGGKEVTRVVGAN---------PAAIKQA 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8993NP_647716.1 Thioredoxin_like 39..138 CDD:294274 37/98 (38%)
TRX2NP_011725.3 thioredoxin 6..104 CDD:200072 41/104 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.