DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8993 and THX

DIOPT Version :9

Sequence 1:NP_647716.1 Gene:CG8993 / 38301 FlyBaseID:FBgn0035334 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_564566.1 Gene:THX / 841454 AraportID:AT1G50320 Length:182 Species:Arabidopsis thaliana


Alignment Length:122 Identity:40/122 - (32%)
Similarity:67/122 - (54%) Gaps:3/122 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LASG-QQIRMLSVSAPRQEIFKVQSAEDFDKKVKNSQQPVIVDFFATWCNPCKLLTPRIESIVGE 79
            |:|| ::.|..|.|..|....|.....:|...|..|.|||:|:|.||||.||||:.|.:|::..|
plant    51 LSSGARRTRKSSSSVIRCGGIKEIGESEFSSTVLESAQPVLVEFVATWCGPCKLIYPAMEALSQE 115

  Fly    80 QAGSIKLAKVDIDEHSELALDYDVAAVPVLVVLQNGKEV--QRMVGLQDEDKIRAWV 134
            ....:.:.|:|.|.:.:|..::.|..:|..::.::||||  .|..|...:.|::.::
plant   116 YGDKLTIVKIDHDANPKLIAEFKVYGLPHFILFKDGKEVPGSRREGAITKAKLKEYI 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8993NP_647716.1 Thioredoxin_like 39..138 CDD:294274 32/98 (33%)
THXNP_564566.1 Thioredoxin_like 76..176 CDD:412351 32/97 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0910
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.