DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8993 and TRX5

DIOPT Version :9

Sequence 1:NP_647716.1 Gene:CG8993 / 38301 FlyBaseID:FBgn0035334 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_175128.1 Gene:TRX5 / 841082 AraportID:AT1G45145 Length:118 Species:Arabidopsis thaliana


Alignment Length:99 Identity:29/99 - (29%)
Similarity:61/99 - (61%) Gaps:5/99 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 EIFKVQSAEDFDKKVKN---SQQPVIVDFFATWCNPCKLLTPRIESIVGEQAGSIKLAKVDIDEH 94
            |:....:.|.:::|||:   |::.:::||.|:||.||:.:.| :.:.:.::..::...|:|:||.
plant     6 EVIACHTLEVWNEKVKDANESKKLIVIDFTASWCPPCRFIAP-VFAEMAKKFTNVVFFKIDVDEL 69

  Fly    95 SELALDYDVAAVPVLVVLQNGKEVQRMVG-LQDE 127
            ..:|.::.|.|:|..|.::.|..:.|:|| .:||
plant    70 QAVAQEFKVEAMPTFVFMKEGNIIDRVVGAAKDE 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8993NP_647716.1 Thioredoxin_like 39..138 CDD:294274 28/93 (30%)
TRX5NP_175128.1 TRX_family 16..108 CDD:239245 27/89 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.