DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8993 and ty2

DIOPT Version :9

Sequence 1:NP_647716.1 Gene:CG8993 / 38301 FlyBaseID:FBgn0035334 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_175021.2 Gene:ty2 / 840939 AraportID:AT1G43560 Length:167 Species:Arabidopsis thaliana


Alignment Length:107 Identity:34/107 - (31%)
Similarity:60/107 - (56%) Gaps:5/107 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ASGQQIRMLSVSAPRQEIFKVQSAEDFDKKVKNSQQPVIVDFFATWCNPCKLLTPRIESIVGEQA 81
            :|..:...|:|.|.:::.|     ..||..::||.:||:|||:||||.||:|:.|.:..:.....
plant    47 SSSTRFAPLTVRAAKKQTF-----NSFDDLLQNSDKPVLVDFYATWCGPCQLMVPILNEVSETLK 106

  Fly    82 GSIKLAKVDIDEHSELALDYDVAAVPVLVVLQNGKEVQRMVG 123
            ..|.:.|:|.:::..||..|.:.|:|..::.::||...|..|
plant   107 DIIAVVKIDTEKYPSLANKYQIEALPTFILFKDGKLWDRFEG 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8993NP_647716.1 Thioredoxin_like 39..138 CDD:294274 29/85 (34%)
ty2NP_175021.2 Thioredoxin_like 64..163 CDD:412351 30/90 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0910
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X935
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.