DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8993 and AT4G12170

DIOPT Version :9

Sequence 1:NP_647716.1 Gene:CG8993 / 38301 FlyBaseID:FBgn0035334 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_192954.2 Gene:AT4G12170 / 826825 AraportID:AT4G12170 Length:153 Species:Arabidopsis thaliana


Alignment Length:100 Identity:35/100 - (35%)
Similarity:54/100 - (54%) Gaps:1/100 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LSVSAPRQE-IFKVQSAEDFDKKVKNSQQPVIVDFFATWCNPCKLLTPRIESIVGEQAGSIKLAK 88
            :|.|.|..: :.:..||.:::..|..|:.||||.|.|..|..|..|.|.:|.:..|....:|...
plant    40 VSSSLPSHDGLVQSLSASEWNSLVIQSKVPVIVVFIAKDCAECGSLMPELEFLDSEYEYMLKFYT 104

  Fly    89 VDIDEHSELALDYDVAAVPVLVVLQNGKEVQRMVG 123
            ||.||..|||.||.:...|:.:|.:.|:|.:|::|
plant   105 VDTDEELELAKDYRIEYHPITIVFKGGEEKERVLG 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8993NP_647716.1 Thioredoxin_like 39..138 CDD:294274 31/84 (37%)
AT4G12170NP_192954.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0910
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.