DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8993 and ATHM2

DIOPT Version :9

Sequence 1:NP_647716.1 Gene:CG8993 / 38301 FlyBaseID:FBgn0035334 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_192261.1 Gene:ATHM2 / 825653 AraportID:AT4G03520 Length:186 Species:Arabidopsis thaliana


Alignment Length:140 Identity:37/140 - (26%)
Similarity:65/140 - (46%) Gaps:28/140 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 TTRRL------ASGQQIR-------MLSVSAPR------------QEI---FKVQSAEDFDKKVK 48
            ::||:      :||.:||       :.|:..||            ||.   .:|.:...:|..|.
plant    31 SSRRMFAVLPESSGLRIRLSLSPASLTSIHQPRVSRLRRAVVCEAQETTTDIQVVNDSTWDSLVL 95

  Fly    49 NSQQPVIVDFFATWCNPCKLLTPRIESIVGEQAGSIKLAKVDIDEHSELALDYDVAAVPVLVVLQ 113
            .:..||:|||:|.||.|||::.|.:..:.....|.||..|::.||.......|.|.::|.:::..
plant    96 KATGPVVVDFWAPWCGPCKMIDPLVNDLAQHYTGKIKFYKLNTDESPNTPGQYGVRSIPTIMIFV 160

  Fly   114 NGKEVQRMVG 123
            .|::...::|
plant   161 GGEKKDTIIG 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8993NP_647716.1 Thioredoxin_like 39..138 CDD:294274 25/85 (29%)
ATHM2NP_192261.1 thioredoxin 85..185 CDD:200072 25/86 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0910
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X935
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.