DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8993 and AT3G56420

DIOPT Version :9

Sequence 1:NP_647716.1 Gene:CG8993 / 38301 FlyBaseID:FBgn0035334 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_001325846.1 Gene:AT3G56420 / 824809 AraportID:AT3G56420 Length:154 Species:Arabidopsis thaliana


Alignment Length:131 Identity:33/131 - (25%)
Similarity:66/131 - (50%) Gaps:10/131 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 NILGQTTRRLASGQQIRMLSVSAPRQEIFKVQSAEDFDKKVKNSQQPVIVDFFATWCNPCKLLTP 71
            |..|||..:..|..::..:|         :::..|:...:..|..:.::|:|.|.||.|||.:.|
plant    27 NSYGQTRSQHGSKGKVHPVS---------RIEKWEEKITEANNHGKILVVNFSAPWCVPCKKIEP 82

  Fly    72 RIESIVGEQAGSIKLAKVDIDEHSELALDYDVAAVPVLVVLQNGKEVQRMVGLQDEDKIRAWVAA 136
            ....:.......| ...||::|.:|.:.:::|.|.|.:|.|::|:::.::||.:..:..:...||
plant    83 VFRDLASRYPSMI-FVTVDVEELAEFSNEWNVEATPTVVFLKDGRQMDKLVGAETSELQKKTAAA 146

  Fly   137 A 137
            |
plant   147 A 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8993NP_647716.1 Thioredoxin_like 39..138 CDD:294274 27/99 (27%)
AT3G56420NP_001325846.1 TRX_family 49..142 CDD:239245 24/93 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.