DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8993 and TRX-M4

DIOPT Version :9

Sequence 1:NP_647716.1 Gene:CG8993 / 38301 FlyBaseID:FBgn0035334 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_188155.1 Gene:TRX-M4 / 820775 AraportID:AT3G15360 Length:193 Species:Arabidopsis thaliana


Alignment Length:118 Identity:35/118 - (29%)
Similarity:64/118 - (54%) Gaps:4/118 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LGQTTR-RLASGQQI--RMLSVSAPRQEIFKVQSAEDFDKKVKNSQQPVIVDFFATWCNPCKLLT 70
            ||...| |:|.|.:|  .....:|...|:..:..:| :..||..|..||:|:|:|.||.||:::.
plant    60 LGANRRTRIARGGRIACEAQDTTAAAVEVPNLSDSE-WQTKVLESDVPVLVEFWAPWCGPCRMIH 123

  Fly    71 PRIESIVGEQAGSIKLAKVDIDEHSELALDYDVAAVPVLVVLQNGKEVQRMVG 123
            |.::.:..:.||..|..|::.||....|..|.:.:||.:::.:.|::...::|
plant   124 PIVDQLAKDFAGKFKFYKINTDESPNTANRYGIRSVPTVIIFKGGEKKDSIIG 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8993NP_647716.1 Thioredoxin_like 39..138 CDD:294274 26/85 (31%)
TRX-M4NP_188155.1 thioredoxin 91..191 CDD:200072 26/87 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0910
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X935
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.