DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8993 and ACHT3

DIOPT Version :9

Sequence 1:NP_647716.1 Gene:CG8993 / 38301 FlyBaseID:FBgn0035334 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_180885.1 Gene:ACHT3 / 817890 AraportID:AT2G33270 Length:273 Species:Arabidopsis thaliana


Alignment Length:84 Identity:24/84 - (28%)
Similarity:44/84 - (52%) Gaps:10/84 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 MLSVSAPRQEIFKVQSAEDFDKKVKNSQQPVIVDFFATWCNPCKLLTPRIESIVGEQAGSIKLAK 88
            |.||::|:..:..:::|.|         :.|:||||:..|..||.|.|:|..| .|:...::..:
plant    95 MKSVTSPQDLVVSLRNAGD---------KLVVVDFFSPSCGGCKALHPKICKI-AEKNPEVEFLQ 149

  Fly    89 VDIDEHSELALDYDVAAVP 107
            |:.:||..|....::..:|
plant   150 VNYEEHRSLCQSLNIHVLP 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8993NP_647716.1 Thioredoxin_like 39..138 CDD:294274 20/69 (29%)
ACHT3NP_180885.1 TRX_family 111..>175 CDD:239245 20/68 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43601
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.