DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8993 and TXNDC5

DIOPT Version :9

Sequence 1:NP_647716.1 Gene:CG8993 / 38301 FlyBaseID:FBgn0035334 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_110437.2 Gene:TXNDC5 / 81567 HGNCID:21073 Length:432 Species:Homo sapiens


Alignment Length:119 Identity:38/119 - (31%)
Similarity:68/119 - (57%) Gaps:7/119 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 SAP--RQEIFKVQSAEDFDKKVKNSQQPVIVDFFATWCNPCKLLTPRIESI-VG-EQAGSIKLAK 88
            |||  :|.:::: ||.:|:..|  :|....:.|||.||..||.|.|..|.: :| |.:.::|:.|
Human   183 SAPELKQGLYEL-SASNFELHV--AQGDHFIKFFAPWCGHCKALAPTWEQLALGLEHSETVKIGK 244

  Fly    89 VDIDEHSELALDYDVAAVPVLVVLQNGKEVQRMVGLQDEDKIRAWVAAAVKQAK 142
            ||..:|.||.....|...|.|:..::||:|.:..|.:|.:.:|.:|.:.:::.:
Human   245 VDCTQHYELCSGNQVRGYPTLLWFRDGKKVDQYKGKRDLESLREYVESQLQRTE 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8993NP_647716.1 Thioredoxin_like 39..138 CDD:294274 34/100 (34%)
TXNDC5NP_110437.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..63
PDI_a_ERp46 61..164 CDD:239303
ER_PDI_fam 66..432 CDD:273457 38/119 (32%)
PDI_a_ERp46 190..290 CDD:239303 33/102 (32%)
PDI_a_ERp46 323..424 CDD:239303
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 429..432
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.