DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8993 and Txn2

DIOPT Version :9

Sequence 1:NP_647716.1 Gene:CG8993 / 38301 FlyBaseID:FBgn0035334 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_445783.1 Gene:Txn2 / 79462 RGDID:71040 Length:166 Species:Rattus norvegicus


Alignment Length:100 Identity:49/100 - (49%)
Similarity:76/100 - (76%) Gaps:0/100 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 FKVQSAEDFDKKVKNSQQPVIVDFFATWCNPCKLLTPRIESIVGEQAGSIKLAKVDIDEHSELAL 99
            |.||...||..:|.||:.||:|||.|.||.|||:|.||:|.:|.:|.|.:.:||||||:|::||:
  Rat    62 FNVQDGPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAI 126

  Fly   100 DYDVAAVPVLVVLQNGKEVQRMVGLQDEDKIRAWV 134
            :|:|:|||.::.::||..|.:.||::|||::.|::
  Rat   127 EYEVSAVPTVLAIKNGDVVDKFVGIKDEDQLEAFL 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8993NP_647716.1 Thioredoxin_like 39..138 CDD:294274 46/95 (48%)
Txn2NP_445783.1 TRX_family 72..162 CDD:239245 44/89 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350948
Domainoid 1 1.000 115 1.000 Domainoid score I5875
eggNOG 1 0.900 - - E2759_KOG0910
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40849
Inparanoid 1 1.050 121 1.000 Inparanoid score I4666
OMA 1 1.010 - - QHG48905
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 1 1.000 - - otm44583
orthoMCL 1 0.900 - - OOG6_100096
Panther 1 1.100 - - LDO PTHR43601
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X935
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.