DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8993 and txn2

DIOPT Version :9

Sequence 1:NP_647716.1 Gene:CG8993 / 38301 FlyBaseID:FBgn0035334 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_001008161.1 Gene:txn2 / 493523 XenbaseID:XB-GENE-943373 Length:170 Species:Xenopus tropicalis


Alignment Length:123 Identity:57/123 - (46%)
Similarity:89/123 - (72%) Gaps:0/123 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 TTRRLASGQQIRMLSVSAPRQEIFKVQSAEDFDKKVKNSQQPVIVDFFATWCNPCKLLTPRIESI 76
            |:.||.....:|.:|.|.|.:..|.||.|:||.::|..|:.||:|||.|.||.|||:|.||:|.:
 Frog    42 TSSRLHPHCNLRPISTSTPCRVTFNVQDADDFQERVVGSETPVVVDFHAQWCGPCKILAPRLEKV 106

  Fly    77 VGEQAGSIKLAKVDIDEHSELALDYDVAAVPVLVVLQNGKEVQRMVGLQDEDKIRAWV 134
            |.:|.|.:.:||||||:|::|||:::|:|||.::.::||..|.:.|||:|||::.|::
 Frog   107 VAKQQGKVVMAKVDIDDHTDLALEFEVSAVPTVLAIKNGDVVDKFVGLKDEDQLDAFL 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8993NP_647716.1 Thioredoxin_like 39..138 CDD:294274 47/96 (49%)
txn2NP_001008161.1 Thioredoxin_like 69..168 CDD:381987 47/96 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 117 1.000 Domainoid score I5836
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40849
Inparanoid 1 1.050 130 1.000 Inparanoid score I4511
OMA 1 1.010 - - QHG48905
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 1 1.000 - - otm47621
Panther 1 1.100 - - LDO PTHR43601
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X935
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.