DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8993 and CG3719

DIOPT Version :9

Sequence 1:NP_647716.1 Gene:CG8993 / 38301 FlyBaseID:FBgn0035334 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_651990.1 Gene:CG3719 / 44736 FlyBaseID:FBgn0024986 Length:160 Species:Drosophila melanogaster


Alignment Length:118 Identity:43/118 - (36%)
Similarity:72/118 - (61%) Gaps:2/118 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ASGQQIRMLSVSAPRQEIFKVQSAEDFDKKVKNSQQPVIVDFFATWCNPCKLLTPRIESIVGEQA 81
            |.|.| :.||.|....::..::...:||:||.||..||||:|.|.||:|||:|||::..:: |.:
  Fly    34 ARGTQ-KYLSQSQHLHKMLVIKDHYEFDQKVINSDNPVIVNFHAEWCDPCKILTPKMLELL-ENS 96

  Fly    82 GSIKLAKVDIDEHSELALDYDVAAVPVLVVLQNGKEVQRMVGLQDEDKIRAWV 134
            ..|.||.:|::.:.:|...::|.|||.::..:||..|.:.:||.|.:.|...:
  Fly    97 NEIDLAVIDVETNLDLVETFEVKAVPAVLAFRNGVVVDKFIGLVDANSIETLI 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8993NP_647716.1 Thioredoxin_like 39..138 CDD:294274 37/96 (39%)
CG3719NP_651990.1 TRX_family 58..150 CDD:239245 37/93 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0910
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 1 1.000 - - mtm9760
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43601
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X935
76.920

Return to query results.
Submit another query.