DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8993 and txn2

DIOPT Version :9

Sequence 1:NP_647716.1 Gene:CG8993 / 38301 FlyBaseID:FBgn0035334 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_991204.1 Gene:txn2 / 402938 ZFINID:ZDB-GENE-040426-1795 Length:166 Species:Danio rerio


Alignment Length:124 Identity:52/124 - (41%)
Similarity:82/124 - (66%) Gaps:7/124 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 MLSVSAP-------RQEIFKVQSAEDFDKKVKNSQQPVIVDFFATWCNPCKLLTPRIESIVGEQA 81
            :||.|.|       |...|.||..:||.::|.||:.||::||.|.||.|||:|.||:|..:.:|.
Zfish    43 LLSRSIPRLPYITSRSVSFNVQDHDDFTERVINSELPVLIDFHAQWCGPCKILGPRLEKAIAKQK 107

  Fly    82 GSIKLAKVDIDEHSELALDYDVAAVPVLVVLQNGKEVQRMVGLQDEDKIRAWVAAAVKQ 140
            |.:.:||||||||::||::|.|:|||.::.::.|..:.:.||::|||::..:|...:.|
Zfish   108 GRVTMAKVDIDEHTDLAIEYGVSAVPTVIAMRGGDVIDQFVGIKDEDQLDTFVEKLIGQ 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8993NP_647716.1 Thioredoxin_like 39..138 CDD:294274 43/98 (44%)
txn2NP_991204.1 TRX_family 67..161 CDD:239245 42/93 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592662
Domainoid 1 1.000 110 1.000 Domainoid score I6249
eggNOG 1 0.900 - - E2759_KOG0910
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40849
Inparanoid 1 1.050 120 1.000 Inparanoid score I4749
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 1 1.000 - - otm26243
orthoMCL 1 0.900 - - OOG6_100096
Panther 1 1.100 - - LDO PTHR43601
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X935
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.760

Return to query results.
Submit another query.