DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8993 and pdia3

DIOPT Version :9

Sequence 1:NP_647716.1 Gene:CG8993 / 38301 FlyBaseID:FBgn0035334 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_989329.1 Gene:pdia3 / 394954 XenbaseID:XB-GENE-976328 Length:501 Species:Xenopus tropicalis


Alignment Length:145 Identity:42/145 - (28%)
Similarity:66/145 - (45%) Gaps:22/145 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQRQIIN---ILGQTTRRLASGQQIRMLSVSAPRQEIFKVQSAEDFDKKVKNSQQPV-IVDFFAT 61
            |.||::.   :|..|....|:|..:..|             :.::|:..|  ||..: :|:|||.
 Frog     1 MNRQLLGAFFLLAVTAGTQAAGSDVLDL-------------TDDNFESTV--SQHSILLVEFFAP 50

  Fly    62 WCNPCKLLTPRIESIVGEQAGSIKLAKVDIDEHSELALDYDVAAVPVLVVLQNGKEVQRMVGLQD 126
            ||..||.|.|..|....:..|::.|||||...:|.....|.|:..|.|.:.::|::.....|.:.
 Frog    51 WCGHCKKLAPEYEIAATKLKGTLSLAKVDCTANSNTCNKYGVSGYPTLKIFRDGEDSGSYDGPRT 115

  Fly   127 EDKIRAWVAAAVKQA 141
            .|.|   |:...|||
 Frog   116 ADGI---VSTMKKQA 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8993NP_647716.1 Thioredoxin_like 39..138 CDD:294274 31/99 (31%)
pdia3NP_989329.1 ER_PDI_fam 23..483 CDD:273457 35/123 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.