DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8993 and CG8517

DIOPT Version :9

Sequence 1:NP_647716.1 Gene:CG8993 / 38301 FlyBaseID:FBgn0035334 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_611446.3 Gene:CG8517 / 37268 FlyBaseID:FBgn0034472 Length:145 Species:Drosophila melanogaster


Alignment Length:131 Identity:67/131 - (51%)
Similarity:92/131 - (70%) Gaps:6/131 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RRLASGQQIRML------SVSAPRQEIFKVQSAEDFDKKVKNSQQPVIVDFFATWCNPCKLLTPR 72
            |||...:::..|      ..|..:|.||.|::.:||:::|.||.:||:|||.|:||.|||.|.||
  Fly     5 RRLFRAKRLMNLMKANRGMTSTGKQPIFDVETRKDFEQRVINSDRPVVVDFHASWCCPCKALAPR 69

  Fly    73 IESIVGEQAGSIKLAKVDIDEHSELALDYDVAAVPVLVVLQNGKEVQRMVGLQDEDKIRAWVAAA 137
            :|::|.||.|.::||:||||||.||||||:|.:||.|||:.|||.|.||||||..:.:|.|:..|
  Fly    70 LENVVSEQEGRVRLARVDIDEHGELALDYNVGSVPSLVVISNGKVVNRMVGLQTSEYLRKWLHKA 134

  Fly   138 V 138
            |
  Fly   135 V 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8993NP_647716.1 Thioredoxin_like 39..138 CDD:294274 56/98 (57%)
CG8517NP_611446.3 Thioredoxin_like 36..135 CDD:412351 56/98 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465012
Domainoid 1 1.000 110 1.000 Domainoid score I6249
eggNOG 1 0.900 - - E2759_KOG0910
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 120 1.000 Inparanoid score I4749
Isobase 1 0.950 - 0 Normalized mean entropy S1127
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 1 1.000 - - otm26243
orthoMCL 1 0.900 - - OOG6_100096
Panther 1 1.100 - - P PTHR43601
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X935
1211.750

Return to query results.
Submit another query.