DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8993 and CG18130

DIOPT Version :9

Sequence 1:NP_647716.1 Gene:CG8993 / 38301 FlyBaseID:FBgn0035334 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_572772.1 Gene:CG18130 / 32161 FlyBaseID:FBgn0030359 Length:706 Species:Drosophila melanogaster


Alignment Length:117 Identity:23/117 - (19%)
Similarity:55/117 - (47%) Gaps:31/117 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VQSAEDFDKKVKNSQQP--VIVDFFATWCNPCKLLTPRIESIVGEQAGSIKLAKVDI-DEHSELA 98
            :|:.|:.::.:   ::|  :::|.::.||.||:           ...||::..|:|: .::..||
  Fly    14 IQTDEELERFM---ERPGLLVLDVYSEWCGPCQ-----------GMVGSLRKIKLDVGGDNLHLA 64

  Fly    99 L----------DYDVAAVPVLVVLQNGKEVQRMVGLQDEDKIRAWVAAAVKQ 140
            :          .::..:.|:.:.:..|:.|..:.| .|..|:   |:..||:
  Fly    65 ICKSDTITALKRFNKRSEPIWLFVTGGRAVNLLFG-SDVPKL---VSLLVKE 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8993NP_647716.1 Thioredoxin_like 39..138 CDD:294274 20/111 (18%)
CG18130NP_572772.1 TRX_NDPK 11..112 CDD:239246 22/115 (19%)
DUF4746 234..556 CDD:292550
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.