DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8993 and prtp

DIOPT Version :9

Sequence 1:NP_647716.1 Gene:CG8993 / 38301 FlyBaseID:FBgn0035334 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_001188583.1 Gene:prtp / 32124 FlyBaseID:FBgn0030329 Length:416 Species:Drosophila melanogaster


Alignment Length:133 Identity:34/133 - (25%)
Similarity:64/133 - (48%) Gaps:16/133 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LGQTTRRLASGQQIRMLSVSAPRQEIFKVQSAED-FDKKVKNSQQPVIVDFFATWCNPCKLLTPR 72
            ||:..|     :|:..|::..      .|...|| |.|.|.....  .|.|||.||:.|:.|.|.
  Fly   152 LGEVKR-----EQVENLNIGK------VVDLTEDTFAKHVSTGNH--FVKFFAPWCSHCQRLAPT 203

  Fly    73 IESIVGE--QAGSIKLAKVDIDEHSELALDYDVAAVPVLVVLQNGKEVQRMVGLQDEDKIRAWVA 135
            .|.:..|  :..::.::|:|..:...:..|::|...|.|:.:::||::::..|.:|...::.:|.
  Fly   204 WEDLAKELIKEPTVTISKIDCTQFRSICQDFEVKGYPTLLWIEDGKKIEKYSGARDLSTLKTYVE 268

  Fly   136 AAV 138
            ..|
  Fly   269 KMV 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8993NP_647716.1 Thioredoxin_like 39..138 CDD:294274 27/101 (27%)
prtpNP_001188583.1 PDI_a_ERp46 38..140 CDD:239303
ER_PDI_fam 39..409 CDD:273457 34/133 (26%)
PDI_a_ERp46 167..267 CDD:239303 27/107 (25%)
PDI_a_ERp46 303..407 CDD:239303
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.