DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8993 and TrxT

DIOPT Version :9

Sequence 1:NP_647716.1 Gene:CG8993 / 38301 FlyBaseID:FBgn0035334 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_001284881.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster


Alignment Length:98 Identity:26/98 - (26%)
Similarity:64/98 - (65%) Gaps:2/98 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IFKVQSAEDFDKK-VKNSQQPVIVDFFATWCNPCKLLTPRIESIVGEQAGSIKLAKVDIDEHSEL 97
            ::.|::.:|.|:: :....:.|::||:|.||.|||::.|:::.:..:.:..:.:.||::||:.::
  Fly     2 VYPVRNKDDLDQQLILAEDKLVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENEDI 66

  Fly    98 ALDYDVAAVPVLVVLQNGKEVQRMVGLQDEDKI 130
            .::|:|.::|..|.::.|..::..||. :.||:
  Fly    67 TVEYNVNSMPTFVFIKGGNVLELFVGC-NSDKL 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8993NP_647716.1 Thioredoxin_like 39..138 CDD:294274 25/93 (27%)
TrxTNP_001284881.1 Thioredoxin 13..105 CDD:278513 23/87 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464317
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.